PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_D39684C41.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 310aa    MW: 33757.9 Da    PI: 4.8204
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_D39684C41.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Traes_2DL_D39684C41.1 16 RGSWTPEEDMRLIAYIHKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                           89******************************99************97 PP

2Myb_DNA-binding56.47e-1869114148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE+e l++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Traes_2DL_D39684C41.1  69 RGNFTVEEEETLIKLHNMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23766IPR009057Homeodomain-like
PROSITE profilePS5129415.2791163IPR017930Myb domain
SuperFamilySSF466891.16E-3013110IPR009057Homeodomain-like
SMARTSM007171.7E-131565IPR001005SANT/Myb domain
PfamPF002497.9E-161663IPR001005SANT/Myb domain
CDDcd001671.05E-101863No hitNo description
PROSITE profilePS5129424.94564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2667118IPR009057Homeodomain-like
SMARTSM007176.7E-1668116IPR001005SANT/Myb domain
PfamPF002493.4E-1669114IPR001005SANT/Myb domain
CDDcd001671.18E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IHKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETL IKLHNMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAA  120
SAGEQKKGGA KGKKKTTCVD VPAPAPSPSP SSSTTTTTTT TTNCSSGESG EQSNTSNELE  180
FELDKIEIPM LDLGFDLDML LDTVTNTHCP VISSAPTSTC SSASPPCVVD DDTLLDLPEI  240
DIVPELWSIM DGEGACAETA QAPWSNAAPC HGNGTEASAA TADDEDGKEW WLEDLEKELG  300
LWGPIDDYQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486490.0AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696890.0AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653723.11e-133PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-105MYB1_MAIZE; Myb-related protein Zm1
TrEMBLW5C0N70.0W5C0N7_WHEAT; Uncharacterized protein
STRINGMLOC_53640.11e-155(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.18e-69myb domain protein 63
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]